Transcript Information: R_Transcript_140462.p1


Annotated TAIR IDAT2G30620.1
Annotated Gene Namewinged-helix DNA-binding transcription factor family protein
Annotated Gene Symbol(s)
Annotation TypeHomolog
Chromosome Positionchr2:13045360-13046267 | Forward length=273
E-Value2E-05
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 12.1991519222553
Replicate 22.0237397991613
Replicate 31.3799239515755
Condition 2: 8 Hour
Replicate 10.59002084210229
Replicate 21.8858575046783
Replicate 31.9682469347408
Condition 3: 24 Hour
Replicate 11.6596005224846
Replicate 23.454438139488
Replicate 32.1096582830744


Fold Change




FASTA Sequences

Nucleotide Sequence

>R_Transcript_140462.p1 GENE.R_Transcript_140462~~R_Transcript_140462.p1 ORF type:internal len:83 (+),score=7.61 R_Transcript_140462:2-247(+)
AAGAAAGCCTCTGCTCCTAAGAAATCCAAATCCTCTCCTTCTCATCCTCCCTACATCGAGGTATCCTTCTCTCTTTCTCTTTCTCTCTCCTCCATTTCTCATTTTCTGATTTTCTCTCTTCTGTGGCTAATACTAACGGATTTCTGTGTAATTTTACTCACAGATGATAACGGAAGCACTAGTATCGCTCAAGGAGAGAACAGGATCCAGCCACTACGCGATCGCCAAACACATCGAAGAGCAGCA

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>R_Transcript_140462.p1 GENE.R_Transcript_140462~~R_Transcript_140462.p1 ORF type:internal len:83 (+),score=7.61 R_Transcript_140462:2-247(+)
KKASAPKKSKSSPSHPPYIEVSFSLSLSLSSISHFLIFSLLWLILTDFCVILLTDDNGSTSIAQGENRIQPLRDRQTHRRAA

Click here to download the sequence:
Link to NCBI Protein BLAST