Annotated TAIR ID | |
Annotated Gene Name | |
Annotated Gene Symbol(s) | |
Annotation Type | |
Chromosome Position | |
E-Value |
Replicate 1 | 0.66374403471705 |
Replicate 2 | 0.57262637498995 |
Replicate 3 | 0.41648613811186 |
Replicate 1 | 0.89039508899073 |
Replicate 2 | 0 |
Replicate 3 | 0.49504392601055 |
Replicate 1 | 1.0435366921684 |
Replicate 2 | 1.0025117677535 |
Replicate 3 | 0.3979582670345 |
>R_Transcript_179207.p2 GENE.R_Transcript_179207~~R_Transcript_179207.p2 ORF type:complete len:110 (+),score=2.78 R_Transcript_179207:1224-1553(+)
ATGATCTCCATACAAAATGAAATTTATAAACACGCATTCCCTTCCATCTTCCCCATCCTATTTACCTTCCCCTTCCCTATTTCCCTTTCCCCATTCCCTTTTCCCCATCCCCTTCCTTATTTCCATTTCCTTTTCCCCTTTCGCTTCCTTTTTCCCTTTCCCCTTTCCTTTTCCTCTTTCCCTTCCTCTTTCCCTTTCCCATTTCCCTTCCCCTTCCCTCTTTACATTCCCATTCCCCTTTCCCCTTTCACCTTCCCCATTTCCCTTATCCTTCCCTCTTCCCCTTCCCCTCTCCCCCTTCCCTATTTCCTTACCACTATTCTAAAGTAA
Click here to download the sequence:
Link to NCBI Nucleotide BLAST
>R_Transcript_179207.p2 GENE.R_Transcript_179207~~R_Transcript_179207.p2 ORF type:complete len:110 (+),score=2.78 R_Transcript_179207:1224-1553(+)
MISIQNEIYKHAFPSIFPILFTFPFPISLSPFPFPHPLPYFHFLFPFRFLFPFPLSFSSFPSSFPFPFPFPFPLYIPIPLSPFTFPISLILPSSPSPLPLPYFLTTILK*
Click here to download the sequence:
Link to NCBI Protein BLAST