Transcript Information: R_Transcript_218722.p1


Annotated TAIR IDATMG01250.1
Annotated Gene NameRNA-directed DNA polymerase (reverse transcriptase)
Annotated Gene Symbol(s)ORF102
Annotation TypeHomolog
Chromosome PositionchrM:310514-310882 | Forward length=122
E-Value7E-05
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 10
Replicate 20
Replicate 30.27935045848966
Condition 2: 8 Hour
Replicate 10.89582432733824
Replicate 20.27269368099007
Replicate 30
Condition 3: 24 Hour
Replicate 10
Replicate 20
Replicate 30


Fold Change




FASTA Sequences

Nucleotide Sequence

>R_Transcript_218722.p1 GENE.R_Transcript_218722~~R_Transcript_218722.p1 ORF type:complete len:82 (+),score=7.32 R_Transcript_218722:218-463(+)
ATGCCCACCAAGAAACCCGAGACCACACCCCTAGCACAGCTCTCTCCAGCAACCTACTCAAAACATCCACCACAGAGTAAACAGGAAAGGAGACAACAGGTCCCCCTGACGCAGCCCTCGGGAGGAAGTAAACCACTCCCTAGGAGCCCCATTAACCAGAACAGAGAAGAAGGCATTAGAAAAACACCCCCTAATCCATTGCCTCCACCTCCCACCAAACCCCTTCCGAATAAGCACCCGATCTAG

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>R_Transcript_218722.p1 GENE.R_Transcript_218722~~R_Transcript_218722.p1 ORF type:complete len:82 (+),score=7.32 R_Transcript_218722:218-463(+)
MPTKKPETTPLAQLSPATYSKHPPQSKQERRQQVPLTQPSGGSKPLPRSPINQNREEGIRKTPPNPLPPPPTKPLPNKHPI*

Click here to download the sequence:
Link to NCBI Protein BLAST