Transcript Information: R_Transcript_401282.p1


Annotated TAIR IDAT1G78300.1
Annotated Gene Namegeneral regulatory factor 2
Annotated Gene Symbol(s)GRF2, 14-3-3OMEGA, GF14 OMEGA
Annotation TypeOrtholog
Chromosome Positionchr1:29461883-29463052 | Forward length=259
E-Value6.7E-52
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 10.33801779545776
Replicate 20
Replicate 30.42419884437319
Condition 2: 8 Hour
Replicate 10
Replicate 20
Replicate 30
Condition 3: 24 Hour
Replicate 10
Replicate 20
Replicate 30


Fold Change




FASTA Sequences

Nucleotide Sequence

>R_Transcript_401282.p1 GENE.R_Transcript_401282~~R_Transcript_401282.p1 ORF type:internal len:108 (+),score=-2.12,14-3-3|PF00244.16|3.4e-48 R_Transcript_401282:3-323(+)
CGCATCAACGAGTACCGACAGAAGATCGAGAAGGAGCTGCGCGGCATCTGCGACGACATCCTGGCCGTCATCAACGAGCACCTGGTCCCCTCCGCCGCCTCCCCCGAATCCAAGGTCTTCTACTTCAAGATGAAGGGCGACTACCACAGATACCTGGCTGAGTTCCTGACTGGCGACGACCGCAAGACCGCCGCCGACCACGCCCTCGCTGCCTACCAGCAGGCCAGCGAAATCGCCGTCCAGAACCTGCCCCCCACACACCCCATCCGCCTGGGCCTGGCTCTCAACTTCTCTGTCTTCTACTACGAAATCCTCAACAGC

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>R_Transcript_401282.p1 GENE.R_Transcript_401282~~R_Transcript_401282.p1 ORF type:internal len:108 (+),score=-2.12,14-3-3|PF00244.16|3.4e-48 R_Transcript_401282:3-323(+)
RINEYRQKIEKELRGICDDILAVINEHLVPSAASPESKVFYFKMKGDYHRYLAEFLTGDDRKTAADHALAAYQQASEIAVQNLPPTHPIRLGLALNFSVFYYEILNS

Click here to download the sequence:
Link to NCBI Protein BLAST