Transcript Information: R_Transcript_421471.p1


Annotated TAIR IDAT1G42440.1
Annotated Gene NameFUNCTIONS IN: molecular_function unknown; INVOLVED IN: ribosome biogenesis; LOCATED IN: nucleus; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: AARP2CN (InterPro:IPR012948), Protein of unknown function DUF663 (InterPro:IPR007034); BEST Arabidopsis thaliana protein match is: P-loop containing nucleoside triphosphate hydrolases superfamily protein (TAIR:AT1G06720.1); Has 2741 Blast hits to 2088 proteins in 291 species: Archae - 2; Bacteria - 131; Metazoa - 833; Fungi - 650; Plants - 171; Viruses - 49; Other Eukaryotes - 905 (source: NCBI BLink).
Annotated Gene Symbol(s)
Annotation TypeOrtholog
Chromosome Positionchr1:15895528-15899939 | Reverse length=793
E-Value8.8E-11
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 10
Replicate 20.2560524441012
Replicate 30
Condition 2: 8 Hour
Replicate 10
Replicate 20
Replicate 30
Condition 3: 24 Hour
Replicate 10
Replicate 20.80689971550893
Replicate 30


Fold Change




FASTA Sequences

Nucleotide Sequence

>R_Transcript_421471.p1 GENE.R_Transcript_421471~~R_Transcript_421471.p1 ORF type:5prime_partial len:82 (+),score=8.06,RIBIOP_C|PF04950.8|1.8e-06 R_Transcript_421471:2-247(+)
TTGCAGCCTGTTGAAGTATGGACTAAATGCGGACGTCGTGGGCGTGTCAAGGAGCCTGTTGGTACTCATGGTATGTTTCTTTCTGTCCCATTTCACCCTCTTAAATTGTTGTTAAAGCTAATCTCTTTGCATTCGGCTTTCTTAGTTTTCTTATGTAGGGAGTATATTGCTCTCTTCCTTTCCATTTTGATTAGGAAACGAAGGGCTGGGGTGGGGGGTTTCATTTCACCCTCCTTTGTGCTCTAA

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>R_Transcript_421471.p1 GENE.R_Transcript_421471~~R_Transcript_421471.p1 ORF type:5prime_partial len:82 (+),score=8.06,RIBIOP_C|PF04950.8|1.8e-06 R_Transcript_421471:2-247(+)
LQPVEVWTKCGRRGRVKEPVGTHGMFLSVPFHPLKLLLKLISLHSAFLVFLCREYIALFLSILIRKRRAGVGGFISPSFVL*

Click here to download the sequence:
Link to NCBI Protein BLAST