Transcript Information: R_Transcript_430446.p1


Annotated TAIR IDAT1G32120.1
Annotated Gene NameFUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: membrane; EXPRESSED IN: 14 plant structures; EXPRESSED DURING: 4 anthesis, C globular stage, F mature embryo stage, petal differentiation and expansion stage, E expanded cotyledon stage; CONTAINS InterPro DOMAIN/s: Aminotransferase-like, plant mobile domain (InterPro:IPR019557), Protein of unknown function DUF716 (InterPro:IPR006904); BEST Arabidopsis thaliana protein match is: Aminotransferase-like, plant mobile domain family protein (TAIR:AT1G51538.1); Has 16736 Blast hits to 9656 proteins in 576 species: Archae - 4; Bacteria - 1182; Metazoa - 7098; Fungi - 2631; Plants - 1178; Viruses - 174; Other Eukaryotes - 4469 (source: NCBI BLink).
Annotated Gene Symbol(s)
Annotation TypeHomolog
Chromosome Positionchr1:11552926-11558608 | Forward length=1206
E-Value0.0004
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 10.15468610978575
Replicate 20
Replicate 30
Condition 2: 8 Hour
Replicate 10
Replicate 20
Replicate 30
Condition 3: 24 Hour
Replicate 10
Replicate 20
Replicate 30.18548902277032


Fold Change




FASTA Sequences

Nucleotide Sequence

>R_Transcript_430446.p1 GENE.R_Transcript_430446~~R_Transcript_430446.p1 ORF type:internal len:118 (+),score=13.50,PMD|PF10536.5|1.5e-11 R_Transcript_430446:1-351(+)
TTTATTGCCATCAGATCAAGCTACCTTACCTTGAGACATGAGGACCATTGCATTGTGGAGCCATATTGCCCTCACCGCTTCAGCAGACAATTTGGCTTCCACCAAGATGTGCCTAGCAATTTGGCTATGGACCTTCGTGACGGGTCTCGGGAGAAGTTGTTCCAATTCTTCTTAACTAGTGTTCGTGTTGGAACAAATTCTAAGTTTATGATACCCGCCAAGAGTCTGAACTTTCAGGCACGTGTGACTCCGGCTTACAGTGCATGGTGGTTATCTGTTTATCGTCCAATCCAACACTCCCGTGCTTCCAGTCCTCTCAAGTCTGCAACTCCACGTGGGGGGTCACGTGAT

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>R_Transcript_430446.p1 GENE.R_Transcript_430446~~R_Transcript_430446.p1 ORF type:internal len:118 (+),score=13.50,PMD|PF10536.5|1.5e-11 R_Transcript_430446:1-351(+)
FIAIRSSYLTLRHEDHCIVEPYCPHRFSRQFGFHQDVPSNLAMDLRDGSREKLFQFFLTSVRVGTNSKFMIPAKSLNFQARVTPAYSAWWLSVYRPIQHSRASSPLKSATPRGGSRD

Click here to download the sequence:
Link to NCBI Protein BLAST