Annotated TAIR ID | AT4G26560.1 |
Annotated Gene Name | calcineurin B-like protein 7 |
Annotated Gene Symbol(s) | CBL7 |
Annotation Type | Homolog |
Chromosome Position | chr4:13406733-13407973 | Reverse length=214 |
E-Value | 8E-07 |
Replicate 1 | 0.20281067727465 |
Replicate 2 | 0.46658445369551 |
Replicate 3 | 0 |
Replicate 1 | 0 |
Replicate 2 | 0 |
Replicate 3 | 0 |
Replicate 1 | 0 |
Replicate 2 | 0 |
Replicate 3 | 0 |
>R_Transcript_467141.p1 GENE.R_Transcript_467141~~R_Transcript_467141.p1 ORF type:internal len:90 (+),score=19.72,EF-hand_1|PF00036.28|0.058,EF-hand_1|PF00036.28|1e-06,EF-hand_7|PF13499.2|1.2e-10,EF-hand_7|PF13499.2|4.5e+03,EF-hand_6|PF13405.2|0.088,EF-hand_6|PF13405.2|5.8e-06,EF-hand_5|PF13202.2|6.7,EF-hand_5|PF13202.2|9.3e-05 R_Transcript_467141:2-268(+)
AATGTGTTTGCTTCATTGGACAGAAATCACACTGGAGAGGTCGATTTCAGAGACTACATGATTGCGCTCTCCATCGCATCAGGAGATTCTGTGGAATCAAAATTGAAGTTATCCTTCAACATGTATGATTTGGATAAGAATGGAACCATCGAAAAGGAAGAATTTGCACAAATCTTGTCAATCATCGTTCAAATGGGAGGATTATCCAACAATAAAGATTTGATCCAAGGAAAGACTACTGAAGAATTGACTGATAGCTTGTTCAAG
Click here to download the sequence:
Link to NCBI Nucleotide BLAST
>R_Transcript_467141.p1 GENE.R_Transcript_467141~~R_Transcript_467141.p1 ORF type:internal len:90 (+),score=19.72,EF-hand_1|PF00036.28|0.058,EF-hand_1|PF00036.28|1e-06,EF-hand_7|PF13499.2|1.2e-10,EF-hand_7|PF13499.2|4.5e+03,EF-hand_6|PF13405.2|0.088,EF-hand_6|PF13405.2|5.8e-06,EF-hand_5|PF13202.2|6.7,EF-hand_5|PF13202.2|9.3e-05 R_Transcript_467141:2-268(+)
NVFASLDRNHTGEVDFRDYMIALSIASGDSVESKLKLSFNMYDLDKNGTIEKEEFAQILSIIVQMGGLSNNKDLIQGKTTEELTDSLFK
Click here to download the sequence:
Link to NCBI Protein BLAST