Transcript Information: S_Transcript_139202.p2


Annotated TAIR IDAT5G64230.1
Annotated Gene Nameunknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 9 plant structures; EXPRESSED DURING: 4 anthesis, petal differentiation and expansion stage; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G19920.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink).
Annotated Gene Symbol(s)
Annotation TypeHomolog
Chromosome Positionchr5:25692572-25693909 | Forward length=379
E-Value2E-13
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 14.9899377315963
Replicate 26.0672671283166
Replicate 34.1496156188101
Condition 2: 8 Hour
Replicate 11.3328368948208
Replicate 20
Replicate 30
Condition 3: 24 Hour
Replicate 19.0110144398701
Replicate 29.6321199199476
Replicate 312.295746647494


Fold Change




FASTA Sequences

Nucleotide Sequence

>S_Transcript_139202.p2 GENE.S_Transcript_139202~~S_Transcript_139202.p2 ORF type:5prime_partial len:80 (-),score=22.67 S_Transcript_139202:1057-1296(-)
TGGTACTGGAAATCTAGGGCGAGGGATGGTGGTGCTGGGTGTAACTGGGCTGCTAGTGAGTTGTCAGTTGAGAAGATGGCGGCTGAGCTGCTGTGGCTGGCCCAAAAAATGGAGGCCAGTGGTGGAGTAGAGGCGGCTGTAGAGAAATGGGCTTGGGCTTCGAACTTGGGCTGGCTGGCTTTGTCGGCTGAAGCCCGTACCCAATCCTCCCTTGTCAAGCTCACAGGTAACATCATATGA

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>S_Transcript_139202.p2 GENE.S_Transcript_139202~~S_Transcript_139202.p2 ORF type:5prime_partial len:80 (-),score=22.67 S_Transcript_139202:1057-1296(-)
WYWKSRARDGGAGCNWAASELSVEKMAAELLWLAQKMEASGGVEAAVEKWAWASNLGWLALSAEARTQSSLVKLTGNII*

Click here to download the sequence:
Link to NCBI Protein BLAST