Transcript Information: S_Transcript_210247.p1


Annotated TAIR IDAT4G31980.1
Annotated Gene Nameunknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF247, plant (InterPro:IPR004158), Protein of unknown function DUF862, eukaryotic (InterPro:IPR008580); BEST Arabidopsis thaliana protein match is: Plant protein of unknown function (DUF247) (TAIR:AT5G11290.1); Has 1967 Blast hits to 1844 proteins in 183 species: Archae - 0; Bacteria - 6; Metazoa - 223; Fungi - 83; Plants - 1477; Viruses - 0; Other Eukaryotes - 178 (source: NCBI BLink).
Annotated Gene Symbol(s)
Annotation TypeHomolog
Chromosome Positionchr4:15464905-15469204 | Forward length=680
E-Value3E-06
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 10.33266251543976
Replicate 21.1031394778757
Replicate 31.38320520627
Condition 2: 8 Hour
Replicate 10.53313475792832
Replicate 21.3982405399829
Replicate 30
Condition 3: 24 Hour
Replicate 10.27306104363243
Replicate 20
Replicate 30.31527555506395


Fold Change




FASTA Sequences

Nucleotide Sequence

>S_Transcript_210247.p1 GENE.S_Transcript_210247~~S_Transcript_210247.p1 ORF type:internal len:80 (+),score=12.85,DUF247|PF03140.11|3.6e-08 S_Transcript_210247:3-239(+)
AGGAGGGGTTATTTCCATCAAGAAATTGAGGAAAATGATCGTATATTCTACAAGCCAAGGATGATAGTGGAAGTCAGTCGTGATATAAGGTTAGAAGAAAACCAACTTCCTTTTTTCATCCTCAAGGGTCTATATGACCTAGCATTTGGTCCCTCTCCAAATTCTTTTGTCGATCTTGCCTACAAATTTCTTATGAGAACACAGCGCAATTTTCCTCAAGAAATAGCAAATGTGGAC

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>S_Transcript_210247.p1 GENE.S_Transcript_210247~~S_Transcript_210247.p1 ORF type:internal len:80 (+),score=12.85,DUF247|PF03140.11|3.6e-08 S_Transcript_210247:3-239(+)
RRGYFHQEIEENDRIFYKPRMIVEVSRDIRLEENQLPFFILKGLYDLAFGPSPNSFVDLAYKFLMRTQRNFPQEIANVD

Click here to download the sequence:
Link to NCBI Protein BLAST