Transcript Information: S_Transcript_318134.p2


Annotated TAIR IDAT1G32120.1
Annotated Gene NameFUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: membrane; EXPRESSED IN: 14 plant structures; EXPRESSED DURING: 4 anthesis, C globular stage, F mature embryo stage, petal differentiation and expansion stage, E expanded cotyledon stage; CONTAINS InterPro DOMAIN/s: Aminotransferase-like, plant mobile domain (InterPro:IPR019557), Protein of unknown function DUF716 (InterPro:IPR006904); BEST Arabidopsis thaliana protein match is: Aminotransferase-like, plant mobile domain family protein (TAIR:AT1G51538.1); Has 16736 Blast hits to 9656 proteins in 576 species: Archae - 4; Bacteria - 1182; Metazoa - 7098; Fungi - 2631; Plants - 1178; Viruses - 174; Other Eukaryotes - 4469 (source: NCBI BLink).
Annotated Gene Symbol(s)
Annotation TypeOrtholog
Chromosome Positionchr1:11552926-11558608 | Forward length=1206
E-Value2.1E-27
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 11.2523765287144
Replicate 20.51912446017682
Replicate 30.21697336568942
Condition 2: 8 Hour
Replicate 10.25088694490745
Replicate 20.5263964385818
Replicate 30.50154935541133
Condition 3: 24 Hour
Replicate 10.25699862930111
Replicate 20.26663307736879
Replicate 30.89018980253351


Fold Change




FASTA Sequences

Nucleotide Sequence

>S_Transcript_318134.p2 GENE.S_Transcript_318134~~S_Transcript_318134.p2 ORF type:internal len:85 (-),score=5.08,DUF716|PF04819.8|5.5e+03,DUF716|PF04819.8|3.5e-14 S_Transcript_318134:1-252(-)
GGCAGTGTTGCATCTACTTTTTGGATCCTAATCATTCACTTATTACTAATCCCTTCTCTTCCAACTATTTTCTTTCTTCCCTTGCCAGATGGGGCACTTTGTTTGGTTGCTGCCACAGCATTCTGCTCAGAGTACCTGTTGTTTTACTTCCATTCAACAAATCACAGAGGCTTGGAAGGCTACTACCACTATATACTTGTGCTGCTGATAGGCTTGTGTGTTCTAACCAGTGTTGCCGGTACCCTAGTCCCC

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>S_Transcript_318134.p2 GENE.S_Transcript_318134~~S_Transcript_318134.p2 ORF type:internal len:85 (-),score=5.08,DUF716|PF04819.8|5.5e+03,DUF716|PF04819.8|3.5e-14 S_Transcript_318134:1-252(-)
GSVASTFWILIIHLLLIPSLPTIFFLPLPDGALCLVAATAFCSEYLLFYFHSTNHRGLEGYYHYILVLLIGLCVLTSVAGTLVP

Click here to download the sequence:
Link to NCBI Protein BLAST