Transcript Information: S_Transcript_515520.p1


Annotated TAIR ID
Annotated Gene Name
Annotated Gene Symbol(s)
Annotation Type
Chromosome Position
E-Value
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 10.57854350511262
Replicate 20.23981292997299
Replicate 30
Condition 2: 8 Hour
Replicate 10
Replicate 20
Replicate 30
Condition 3: 24 Hour
Replicate 10
Replicate 20
Replicate 30


Fold Change




FASTA Sequences

Nucleotide Sequence

>S_Transcript_515520.p1 GENE.S_Transcript_515520~~S_Transcript_515520.p1 ORF type:internal len:92 (+),score=7.14 S_Transcript_515520:2-274(+)
GACTTTCATAACAACAATAACATCAATACCAACAATTTTCCTGTCTACTATCAACCTATTGTTGATCCTAATCAATCCCAAAACATCCCTATGGTTGTCTATGGGCAAATTCCTCAACAACCTCAAATCATCTACGCACAACCAACCTATCTCCCACAACAATACACCCCAATCCCACAACAACAATTTCCCCAACAATACCCACAGCAATACATTCAATTGTCTCAAATTCCACAACAAGAGCAACAATTCGAGCAAGAGCAATTCTTGGTC

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>S_Transcript_515520.p1 GENE.S_Transcript_515520~~S_Transcript_515520.p1 ORF type:internal len:92 (+),score=7.14 S_Transcript_515520:2-274(+)
DFHNNNNINTNNFPVYYQPIVDPNQSQNIPMVVYGQIPQQPQIIYAQPTYLPQQYTPIPQQQFPQQYPQQYIQLSQIPQQEQQFEQEQFLV

Click here to download the sequence:
Link to NCBI Protein BLAST