Transcript Information: S_Transcript_53338.p1


Annotated TAIR IDAT1G23720.1
Annotated Gene NameProline-rich extensin-like family protein
Annotated Gene Symbol(s)
Annotation TypeHomolog
Chromosome Positionchr1:8388655-8391342 | Forward length=895
E-Value1E-06
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 11.4155851720841
Replicate 21.4082631632456
Replicate 30.39239864007661
Condition 2: 8 Hour
Replicate 10.22686585443759
Replicate 20.47599677956865
Replicate 30.45352867244641
Condition 3: 24 Hour
Replicate 10.23239237755951
Replicate 20.48220875694356
Replicate 30.80495886399307


Fold Change




FASTA Sequences

Nucleotide Sequence

>S_Transcript_53338.p1 GENE.S_Transcript_53338~~S_Transcript_53338.p1 ORF type:internal len:94 (+),score=12.35 S_Transcript_53338:1-279(+)
CTCCCCACTACTACTCACCACCAACACCAGTCTACAAATCTCCTCCACACTACTATTCTCCTCTCCCCACTACTACTCACCACCAGCACCAGTCTACAAGTCTCCTCCACACTACTACCAGTGTACAAGTCTCCACCAGTTCATAAATACCCACCACCTACACCAGTCTACAAGTCTCCTCCACACTACTACTCACCACCAGTGTACAAGTCTCCACCAGTTCACAAATACACACCACCTACACCAGTCTACAAGTCTCCACCACACTATTATTCACCA

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>S_Transcript_53338.p1 GENE.S_Transcript_53338~~S_Transcript_53338.p1 ORF type:internal len:94 (+),score=12.35 S_Transcript_53338:1-279(+)
LPTTTHHQHQSTNLLHTTILLSPLLLTTSTSLQVSSTLLPVYKSPPVHKYPPPTPVYKSPPHYYSPPVYKSPPVHKYTPPTPVYKSPPHYYSP

Click here to download the sequence:
Link to NCBI Protein BLAST