Transcript Information: S_Transcript_70791.p1


Annotated TAIR IDAT4G24380.1
Annotated Gene NameINVOLVED IN: 10-formyltetrahydrofolate biosynthetic process, folic acid and derivative biosynthetic process; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Serine hydrolase (InterPro:IPR005645); BEST Arabidopsis thaliana protein match is: alpha/beta-Hydrolases superfamily protein (TAIR:AT5G65400.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink).
Annotated Gene Symbol(s)
Annotation TypeOrtholog
Chromosome Positionchr4:12612554-12613586 | Forward length=234
E-Value1.4E-15
Link to Arabidopsis eFP Browser 2.0


Transcripts Per Million


Condition 1: 0 Hour
Replicate 15.5061381865891
Replicate 25.0719056454057
Replicate 34.6636803889565
Condition 2: 8 Hour
Replicate 13.6767914339885
Replicate 25.9143967668243
Replicate 36.3702533072358
Condition 3: 24 Hour
Replicate 15.5239935263571
Replicate 25.7310787894212
Replicate 32.8990855638064


Fold Change




FASTA Sequences

Nucleotide Sequence

>S_Transcript_70791.p1 GENE.S_Transcript_70791~~S_Transcript_70791.p1 ORF type:internal len:87 (+),score=16.42 S_Transcript_70791:1-258(+)
ATTTTCCCTTTCCATGAAAAGGGAACTATAAATCTTATTTTGAGACATTCTAAAAAGGAAACCATTAATCTTATTTTGAGACGGAGGGAGTACTTTGATTTTATGATTCCTGACATAAGCAACATCATTCCAGGAAAGGATGACTTCTTGAAGCCATATGGAGAGGAGCTCCTGAAATCTGTTATTGACCCTGTTGTAATTCATCACCCCAAGGGCCATACAGTTCCTAGGATAGACGAACAGGCATTGCCAACCATG

Click here to download the sequence:
Link to NCBI Nucleotide BLAST

Protein Sequence

>S_Transcript_70791.p1 GENE.S_Transcript_70791~~S_Transcript_70791.p1 ORF type:internal len:87 (+),score=16.42 S_Transcript_70791:1-258(+)
IFPFHEKGTINLILRHSKKETINLILRRREYFDFMIPDISNIIPGKDDFLKPYGEELLKSVIDPVVIHHPKGHTVPRIDEQALPTM

Click here to download the sequence:
Link to NCBI Protein BLAST